C2orf27 (C2orf27B) Rabbit Polyclonal Antibody TA335120 from OriGene Technologies | Biocompare.com

Supplier Images

C2orf27 (C2orf27B) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
C2orf27 (C2orf27B) Rabbit Polyclonal Antibody

The C2orf27 (C2orf27B) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to CDRT15 pseudogene 3, and CDRT15P3. This antibody recognizes Human antigen. The C2orf27 (C2orf27B) Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit polyclonal Anti-MGC50273 Antibody

Product Specs
ItemC2orf27 (C2orf27B) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA335120
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetC2orf27B
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-MGC50273 antibody: synthetic peptide directed towards the N terminal of human MGC50273. Synthetic peptide located within the following region: MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELE
NCBI Full Gene NameCDRT15 pseudogene 3
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
NCBI Gene AliasesC2orf27B

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!